Mol Scientific
  1. Companies
  2. Mol Scientific
  3. Products
  4. Mol Scientific - Model MPE0006729 - ...

Mol ScientificModel MPE0006729 -Adrenocorticotropic hormone, ACTH peptide

SHARE
Mol Scientific offer high-quality Adrenocorticotropic hormone, ACTH peptide product(MPE0006729). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches

Brand: Mol Scientific
Product Name: Adrenocorticotropic hormone, ACTH peptide
Cat #: MPE0006729
Molecular Formula:C210H314N56O57S
Molecular Weight:SYSMEHFRWGKPVGKKRRPVKVYPNGAEDELAEAFPLEF
Three letter code:H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Leu-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH
Peptide Purity (HPLC):
Quantity/Unit:1 Vial