Mol Scientific
Mol Scientific - Model MPE0006959 -B melanoma antigen 4 precursor peptide
FromMol Scientific
Mol Scientific offer high-quality B melanoma antigen 4 precursor peptide product(MPE0006959). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches
Brand: Mol Scientific
Product Name: B melanoma antigen 4 precursor peptide
Cat #: MPE0006959
Molecular Formula:C192H303N47O56S2
Molecular Weight:MAAGAVFLALSAQLLQARLMKEESPVVSWWLEPEDGTAL
Three letter code:H-Met-Ala-Ala-Gly-Ala-Val-Phe-Leu-Ala-Leu-Ser-Ala-Gln-Leu-Leu-Gln-Ala-Arg-Leu-Met-Lys-Glu-Glu-Ser-Pro-Val-Val-Ser-Trp-Trp-Leu-Glu-Pro-Glu-Asp-Gly-Thr-Ala-Leu-OH
Peptide Purity (HPLC):
Quantity/Unit:1 Vial
