Mol Scientific
  1. Companies
  2. Mol Scientific
  3. Products
  4. Mol Scientific - Model MPE0000002 - ...

Mol ScientificModel MPE0000002 -Beta-Amyloid Peptide

SHARE

The discovery of antimicrobial property of this peptide adds a new avenue to understanding the mechanism of the Alzhermer`s disease. It also inhibits Herpes simplex virus 1 (HSV-1) (Bourgade K et al., 2014). It appears to show synergistic effects with magainin 2 in vitro. Beta-amyloid peptide has Antibacterial, Antifungal activity. Beta-amyloid peptide was found in Homo sapiens.

Most popular related searches
  • For research use only,not intended for diagnosticor therapeutic use.
  • Catalog Number: MPE0000002
  • Product Quantity: 5mg/20mg
  • Price: Varies
  • Availability: In Stock

Product Information

  • Product Name: Beta-amyloid peptide
  • Molecular Formula: C194H295N53O58S
  • Molecular Weight: 4329.9
  • Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
  • Three letter code: Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
  • Length (aa): 40
  • Peptide Purity (HPLC): >95%; 98% and 99% purity available upon request
  • Quantity/Unit: 1 Vial
  • *Optional Service: TFA Removal Service is available upon request.

About TFA salt:Many polypeptides were used as trifluoroacetate (TFA). This is because the TFA/H2O buffer system typically forms TFA salts during reverse-phase high performance liquid chromatography (HPLC) purification. In solid-phase peptide synthesis (SPPS), peptides may also be exposed to TFA upon cleavage from the resin support. In a subsequent step, the TFA salt can be converted to another salt form (eg acetate or HCl) by ion exchange.

Acetate is generally the most common counterion of choice, outperforming HCl and TFA salts in later development. They were also chosen because they generally give better freeze-dried cakes, compared to the TFA salts which can produce some ""fluffy"" peptides that are difficult to handle. TFA salts may also cause adverse immune reactions during clinical trials, although there are two FDA-approved drugs on the market as TFA salts, bivalutin and corticorelin. Considering starting with acetate salt form, to avoid making changes later in product development.

On the other hand, certain amino acid side chains may influence which counterion is more suitable for product stability. The sodium salt (Na+) is useful for polypeptides with an acidic isoelectric point (pI), polypeptides containing multiple Asp and Glu, and a C-terminal acid. In many cases, polypeptides with HCl salts as free sulfhydryl groups have better stability against potential oxidative impurities. Likewise, the choice of salt form can also affect the solubility of the peptide. In addition, the salt form can also play a role in secondary structure, some anions can induce or inhibit the helical structure, and can also affect the fiber formation and stability of polypeptides such as amyloid beta-protein (a ß)

Careful consideration of peptide salts from the outset may save costs down the road. The team at Mol Scientific is also here to help you choose the salt form that best suits your research and development needs..

TFA Removal Service is recommended for:

  • Source: Synthetic
  • Storage Guidelines: Store at-20°C for up to 1 year. should be refrigerated after reconstitution. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides
  • Solubility: Soluble in water
  • Appearance: White to off-white powder
  • Shipping: Peptides are shipped at ambient temperature by standard shipment process.