Croyez - Model His-SUMO tag, HEK293 -Human Coronavirus (NL63) Nucleocapsid Protein
Nucleocapsid protein (NP) packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. NP also plays an important role in enhancing the efficiency of sub-genomic viral RNA transcription as well as viral replication. This product is composed of a DNA sequence encoding HCoV-NL63 NP and a polyhistidine-SUMO tag at the N-terminus.
Source :
HEK293
Sequence :
MASVNWADDRAARKKFPPPSFYMPLLVSSDKAPYRVIPRNLVPIGKGNKDEQIGYWNVQERWRMRRGQRVDLPPKVHFYYLGTGPHKDL
KFRQRSDGVVWVAKEGAKTVNTSLGNRKRNQKPLEPKFIALPPELSVVEFEDRSNNSSRASSRSSTRNNSRDSSRSTSRQQSRTRSDSNQSS
SDLVAAVTLALKNLGFDNQSKSPSSSGTSTPKKPNKPLSQPRADKPSQLKKPRWKRVPTREENVIQCFGPRDFHNMGDSDLVQNGVDAKG
FPQLAELIPNQAALFFDSEVSTDEVGDNVQITYTYKMLVAKDNKNLPKFIEQISAFTKPSSIKEMQSQSSHVAQNTVLNASIPESKPLADDDSAI
IEIVNEVLH with polyhistidine-SUMO tag at the N-terminus.
Endotoxin level :
Purity:
>90% as determined by SDS-PAGE. Ni-NTA chromatography
Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution :
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage :
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Note:
Please use within one month after protein reconstitution.
