Mol Scientific
- Home
- Companies
- Mol Scientific
- Products
- Mol Scientific - Model MPE0006152 - ...
Mol Scientific - Model MPE0006152 -Pancreatic polypeptide 1
FromMol Scientific
Mol Scientific offer high-quality Pancreatic polypeptide 1 product(MPE0006152). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches
Brand: Mol Scientific
Product Name: Pancreatic polypeptide 1
Cat #: MPE0006152
Molecular Formula:C201H282N50O57S
Molecular Weight:APSEPMHPGDQASPEQLAKYYDDWWQYITFITRPRF
Three letter code:H-Ala-Pro-Ser-Glu-Pro-Met-His-Pro-Gly-Asp-Gln-Ala-Ser-Pro-Glu-Gln-Leu-Ala-Lys-Tyr-Tyr-Asp-Asp-Trp-Trp-Gln-Tyr-Ile-Thr-Phe-Ile-Thr-Arg-Pro-Arg-Phe-OH
Peptide Purity (HPLC):
Quantity/Unit:1 Vial
