Mol Scientific

Mol ScientificModel MPE0001155 -Pancreatic polypeptide

SHARE
Mol Scientific offer high-quality Pancreatic polypeptide product(MPE0001155). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches

Brand: Mol Scientific

Product Name: Pancreatic polypeptide

Cat #: MPE0001155

Molecular Formula:C187H289N51O52

Molecular Weight:RIAPVFPGKDASVDELAKFYTELQQYLNSINRPRF

Three letter code:H-Arg-Ile-Ala-Pro-Val-Phe-Pro-Gly-Lys-Asp-Ala-Ser-Val-Asp-Glu-Leu-Ala-Lys-Phe-Tyr-Thr-Glu-Leu-Gln-Gln-Tyr-Leu-Asn-Ser-Ile-Asn-Arg-Pro-Arg-Phe-NH2

Peptide Purity (HPLC):

Quantity/Unit:1 Vial

View this product On our product page: https://www.mol-scientific.com/detailspage/pancreatic-polypeptide-riapvfpgkdasvdelakfytelqqylnsinrprf.html

Source:

Synthetic

Storage Guidelines:

Store at-20°C for up to 1 year. should be refrigerated after reconstitution. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

Solubility:

Appearance:

About TFA salt:

Many polypeptides were used as trifluoroacetate (TFA). This is because the TFA/H2O buffer system typically forms TFA salts during reverse-phase high performance liquid chromatography (HPLC) purification. In solid-phase peptide synthesis (SPPS), peptides may also be exposed to TFA upon cleavage from the resin support. In a subsequent step, the TFA salt can be converted to another salt form (eg acetate or HCl) by ion exchange.

Acetate is generally the most common counterion of choice, outperforming HCl and TFA salts in later development. They were also chosen because they generally give better freeze-dried cakes, compared to the TFA salts which can produce some "fluffy" peptides that are difficult to handle. TFA salts may also cause adverse immune reactions during clinical trials, although there are two FDA-approved drugs on the market as TFA salts, bivalutin and corticorelin. Considering starting with acetate salt form, to avoid making changes later in product development.

On the other hand, certain amino acid side chains may influence which counterion is more suitable for product stability. The sodium salt (Na+) is useful for polypeptides with an acidic isoelectric point (pI), polypeptides containing multiple Asp and Glu, and a C-terminal acid. In many cases, polypeptides with HCl salts as free sulfhydryl groups have better stability against potential oxidative impurities. Likewise, the choice of salt form can also affect the solubility of the peptide. In addition, the salt form can also play a role in secondary structure, some anions can induce or inhibit the helical structure, and can also affect the fiber formation and stability of polypeptides such as amyloid beta-protein (a ß)

Careful consideration of peptide salts from the outset may save costs down the road. The team at Mol Scientific is also here to help you choose the salt form that best suits your research and development needs..                                    TFA Removal Service is recommended for:

Peptides that will be used in cellular assays 

Peptides that will be used as APIs or in manufactured products                                    For hydrophilic peptides containing numerous basic residues

About Us 

Mol Scientific is a national high-tech enterprise, committed to providing high quality products and services for our customers. Our products and services are mainly applied in molecular biology, cell biology, immunology, and biomedical fields.

Who We Are?

Mol Scientific is an evolving custom service provider, offering one-stop services for protein and antibody discovery, research, development, and production. As a reliable partner for researchers in basic life sciences and early-stage biomedical development, our high-quality research and development teams of Mol Scientific specialize in the research and development of high-quality biological agents such as genes, peptides, proteins, antibodies, diagnostic reagents, etc., striving to bring our esteemed customers the finest services at highly competitive prices.

We offer highly customized solutions with a combination of expertise, capabilities, flexibility and quality, which perfectly suit to a diversity of needs.

Contact Us

For quote, please fill in the online form or email to  info@mol-scientific.com