Mol Scientific
  1. Companies
  2. Mol Scientific
  3. Products
  4. Mol Scientific - Model MPE0006495 - ...

Mol ScientificModel MPE0006495 -Pancreatic polypeptide

SHARE
Mol Scientific offer high-quality Pancreatic polypeptide product(MPE0006495). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches

Brand: Mol Scientific
Product Name: Pancreatic polypeptide
Cat #: MPE0006495
Molecular Formula:C187H292N56O55S
Molecular Weight:APQEPVYPGDDATPEQMAKYAAELRRYINRLTRPRY
Three letter code:H-Ala-Pro-Gln-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asp-Ala-Thr-Pro-Glu-Gln-Met-Ala-Lys-Tyr-Ala-Ala-Glu-Leu-Arg-Arg-Tyr-Ile-Asn-Arg-Leu-Thr-Arg-Pro-Arg-Tyr-NH2
Peptide Purity (HPLC):
Quantity/Unit:1 Vial