Protein Foundry LLC.
  1. Companies
  2. Protein Foundry LLC.
  3. Products
  4. Protein-Foundry - Model CCL5 - PFP020 - ...

Protein-FoundryModel CCL5 - PFP020 -Recombinant Human Protein Cell

SHARE

Human CCL5, also known as Regulated upon Activation, Normal T cell Expressed and presumably Secreted (RANTES), attracts and activates leukocytes and plays a primary role in the inflammatory immune response. CCL5 activates several G protein-coupled receptors including CCRs 1, 3, 4, and 5. CCL5 binding to CCR5 inhibits the infectivity of M-tropic HIV-1 strains. Proteolytic removal of the two N-terminal residues by CD26 generates a CCL5 variant that functions as a more potent HIV-1 inhibitor and a CCR5 antagonist.

Most popular related searches
  • Amino Acid Sequence: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQ VCANPEKKWVREYINSLEMS  
  • Molecular Weight: 7847.01 Daltons
  • Fusion Tag: N/A
  • Special Characteristic(s): N/A
  • Purity: Purity assessed by HPLC, Mass Spectrometry, and NMR*
  • Source: Human protein expressed in E. coli
  • Physical Form: Lyophilized
  • Solubility: Freely soluble in water **