Protein Foundry LLC.
Protein-Foundry - Model CCL5 - PFP020 -Recombinant Human Protein Cell
Human CCL5, also known as Regulated upon Activation, Normal T cell Expressed and presumably Secreted (RANTES), attracts and activates leukocytes and plays a primary role in the inflammatory immune response. CCL5 activates several G protein-coupled receptors including CCRs 1, 3, 4, and 5. CCL5 binding to CCR5 inhibits the infectivity of M-tropic HIV-1 strains. Proteolytic removal of the two N-terminal residues by CD26 generates a CCL5 variant that functions as a more potent HIV-1 inhibitor and a CCR5 antagonist.
Most popular related searches
g protein-coupled receptor
inflammatory immune response
hiv 1
inflammatory immunity
inflammatory immune
immune response
T-cell
protein expression
inflammatory response
human chemokine
- Amino Acid Sequence: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQ VCANPEKKWVREYINSLEMS
- Molecular Weight: 7847.01 Daltons
- Fusion Tag: N/A
- Special Characteristic(s): N/A
- Purity: Purity assessed by HPLC, Mass Spectrometry, and NMR*
- Source: Human protein expressed in E. coli
- Physical Form: Lyophilized
- Solubility: Freely soluble in water **
