Mol Scientific - Model MPE0002119 -Hemoglobin alpha chain [001-032] peptide
Brand: Mol Scientific
Product Name: Hemoglobin alpha chain [001-032] peptide
Cat #: MPE0002119
Molecular Formula:C146H232N42O45S
Molecular Weight:VLSPADKTNVKAAWGKVGAHAGEYGAEALERM
Three letter code:H-Val-Leu-Ser-Pro-Ala-Asp-Lys-Thr-Asn-Val-Lys-Ala-Ala-Trp-Gly-Lys-Val-Gly-Ala-His-Ala-Gly-Glu-Tyr-Gly-Ala-Glu-Ala-Leu-Glu-Arg-Met-OH
Peptide Purity (HPLC):
Quantity/Unit:1 Vial
About Us
Mol Scientific is a national high-tech enterprise, committed to providing high quality products and services for our customers. Our products and services are mainly applied in molecular biology, cell biology, immunology, and biomedical fields.
Who We Are?
Mol Scientific is an evolving custom service provider, offering one-stop services for protein and antibody discovery, research, development, and production. As a reliable partner for researchers in basic life sciences and early-stage biomedical development, our high-quality research and development teams of Mol Scientific specialize in the research and development of high-quality biological agents such as genes, peptides, proteins, antibodies, diagnostic reagents, etc., striving to bring our esteemed customers the finest services at highly competitive prices.
We offer highly customized solutions with a combination of expertise, capabilities, flexibility and quality, which perfectly suit to a diversity of needs.
Contact Us
For quote, please fill in the online form or email to info@mol-scientific.com
