
Mol Scientific
Mol Scientific - Model MPE0009801 - Hemoglobin beta chain [113-146] peptide
FromMol Scientific
Mol Scientific offer high-quality Hemoglobin beta chain [113-146] peptide product(MPE0009801). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches

Brand: Mol Scientific
Product Name: Hemoglobin beta chain [113-146] peptide
Cat #: MPE0009801
Molecular Formula:C173H260N48O43
Molecular Weight:VLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Three letter code:H-Val-Leu-Ala-His-His-Phe-Gly-Lys-Glu-Phe-Thr-Pro-Pro-Val-Gln-Ala-Ala-Tyr-Gln-Lys-Val-Val-Ala-Gly-Val-Ala-Asn-Ala-Leu-Ala-His-Lys-Tyr-His-OH
Peptide Purity (HPLC):
Quantity/Unit:1 Vial